PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ahy019736
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family GRAS
Protein Properties Length: 230aa    MW: 26082.7 Da    PI: 5.1781
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Ahy#S59526377PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS235.13.1e-721214158373
       GRAS 158 leetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerf 257
                l+etg+rLa fAe+l++pfef+  v++rled++l++L+vk++E++aVn+v+qlh++l +      + +++L l++s++P +vvv+eqea+hn+ ++ +r+
  Ahy019736   1 LNETGDRLAGFAEALNLPFEFHG-VVDRLEDVRLWMLHVKENETVAVNCVFQLHKTLYDVNG-G-ALRDFLGLIRSTNPAMVVVAEQEAEHNDMRLEARV 97 
                689********************.7*******************************944333.2.4689******************************* PP

       GRAS 258 lealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerl.eeaGFkpvplsekaakqaklllrkvksdgyrveeesg 356
                +++l+yysalfds+e  l  +s++r+k+E++ +grei+n+vaceg++r erhe ++kWr+++ e+ GF+ ++++e++  q +ll+++++ d y+v ++s 
  Ahy019736  98 CNSLKYYSALFDSVEHCLEGDSSARRKIEEM-FGREIRNIVACEGSDRLERHEGFGKWRKMMvEQGGFRCLSVTERERVQSQLLMKMYPCDSYSVRNHSS 196
                *******************************.****************************9934589**********************999****8866 PP

       GRAS 357 slv.lgWkdrpLvsvSaW 373
                +++ l+W+d pL++vSaW
  Ahy019736 197 EALsLCWMDIPLFTVSAW 214
                6666************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF035141.1E-691214IPR005202Transcription factor GRAS
PROSITE profilePS5098527.8641194IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 230 aa     Download sequence    Send to blast
LNETGDRLAG FAEALNLPFE FHGVVDRLED VRLWMLHVKE NETVAVNCVF QLHKTLYDVN  60
GGALRDFLGL IRSTNPAMVV VAEQEAEHND MRLEARVCNS LKYYSALFDS VEHCLEGDSS  120
ARRKIEEMFG REIRNIVACE GSDRLERHEG FGKWRKMMVE QGGFRCLSVT ERERVQSQLL  180
MKMYPCDSYS VRNHSSEALS LCWMDIPLFT VSAWAPLDAA GTSSSVSQPI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-271214160374GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016201972.11e-168PREDICTED: scarecrow-like protein 28
SwissprotQ9CAN36e-92SCL28_ARATH; Scarecrow-like protein 28
TrEMBLV7CBL61e-122V7CBL6_PHAVU; Uncharacterized protein
STRINGGLYMA05G03490.31e-121(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G63100.14e-93GRAS family protein